Clickbank Affiliate Blueprints Blog » brian bear

Brian Bear GVO Scam

admin — Tue, 18 Oct 2011 07:57:29 +0000

What can I say? I joined GVO at the time of the relaunch under Brian Bear. The reason I joined GVO was that Brian Bear hosted a Webinar which was available to all his previous GDI Downline members at the time of the relaunch of GVO. Brian made out like he was so very excited to be part of this new venture (GVO) and how he could make us all a lot of money in the process if we signed up with him.

Now at the time I thought well as an Internet Marketer myself previously being part of GDI (which I have found to be a great company and have had a lot of success with) that I would give this a go and if he kicked me off with a few downline members then all well and good I would be on my way to at least breaking even with the costs involved in being part of GVO to start with. Well lets just say that over 1 month later I have had absolutely no contact with Brian ( I have emailed him on numerous occasions) and he has provided me with absolutely no signups.

You may be thinking to yourself at this stage, but Ben he shouldn’t have to provide you with signups, you should be looking for them yourself. Well that may be true, but Brian Bear made out in the webinar before the relaunch of GVO that as part of signing up with him as part of the relaunch that we would be making history and there would be 100′s even 1000′s of people joining in the coming days and he would be placing them all into our downlines so we could all start earning. This NEVER HAPPENED!

Looks to me that the only person who has gotten anything out of GVO is in fact Brian Bear and the reason he wanted a flood of signups is to win the weekly competitions which made him even more cash!

I have actually been investigating Brian Bear for some time and have come to the conclusion that he is part of some quite shady operations in that he uses a lot of hacked / cracked software and shares it with his downline (after he has already cashed in on it of course). He is a member of Black Hat World (well he was, I believe he is currently banned) and I have also discovered that he was sending massive amounts of paid traffic to his website with Google Adsense advertised on them. If you remember back a year or so ago he was always talking about how much money he was making with Adsense. Well guess what??? Google Adsense shut him down for sending fake / bot traffic to his website, yes I even read his post on it from Black Hat World.

As an Internet Marketer I find his methods absolutely appalling in that he keeps massive mailing lists of people and pretends to help them make money online when the only thing he is doing is giving them false hope and making himself richer. He might have been a good guy back when he first started in GDI but now it seems to me the money has gone to his head and now he doesn’t care about the people at all!

Be sure to Like this Article and Post it to Facebook and Twitter to warn other people so that they don’t fall into the same trap that you and I both have!

GVO relaunch – Brian Bear and Tissa Godavitarne Team

admin — Tue, 06 Sep 2011 12:40:07 +0000

My team has a set of Internet Millionaires who we are signing up under and will be enjoying their spillover.

If you have heard of Internet Marketing names such as Mike Filsaime, Brian Bear, Tissa Godavitarne then you know exactly what this can mean for you. These Internet Marketers can help us to fill our downlines from their spillover in GVO. What this means is that we can all become very wealthy if we join with the right teams.

GVO is quite different to other MLM programs such as GDI in that it is structured so that your leaders can give you signups on different levels unlike GDI which only lets you help your Downline Level 1.

GVO has been around for 12 years and used to cost $45 a month per member, but now it is being relaunched with a $9.95 package per month which again if you sign with someone like myself you can be earning that money back very quickly as we feed more and more people into your downline from our massive spillover.

Not only will you be making money with GVO’s affiliate program but also they include for that price an excellent autoresponder, so that means you can get rid of Aweber or other autoresponders given that you will be saving a lot of money with GVO, they have video hosting which is included with the GVO membership.

Ewen Chia is another very well known internet marketer who is currently with GVO, a lot of big time GDI (Global Domains International) marketers are working with GVO to make this relaunch very successful.

Join GVO Today! Click HERE Remember you need to join my team in order to receive my spillover!!!

Want $10 and $37 Payments direct to your Paypal account daily? Click here for your Free Info

How to Get Global Domains Signups Fast and Free

admin — Sat, 14 May 2011 00:07:08 +0000

Getting Global Domains Signups can be hard for a lot of people especially when you don’t understand SEO and the use of Web 2.0 properties such as Facebook, Twitter, and Myspace. Luckily my team helps you build your downline for free. Instead of keeping all of my GDI signups all for myself I like to share my downline members with the rest of my downline, meaning that if someone signs up under me I will move them to my immediate downline members so that they are also making money with Global Domains straight away, this benefits both of us in the long run. Watch the Video below to see my GDI team earnings.

How to Gain More Global Domains GDI Signups

All successful Global Domains International affiliates share a common trait, they are persistent, and they don’t give up. We all have a built-in guidance system. By way of illustration, an interplanetary space vehicle, has a multimillion dollar guidance system. When the spacecraft is on the launching pad, it doesn’t function… because it doesn’t have to. Once the spacecraft is underway, the guidance system kicks in, and performs any midcourse corrections, that are needed to reach it’s destination. Suppose your destination in life is financial independence. You supply the reason. Global Domains International is the greatest vehicle ever devised to get you to that destination.

The reasons why Global Domains International is the best vehicle to obtain financial freedom are many. It has zero risk, is affordable, and appeals to the masses. You can try GDI for one week absolutely free. After that, the cost is only ten dollars per month. On top of that, the territory for participation is the entire planet Earth. In addition, the product is extremely simple, is delivered instantly, and has no side effects. The product does not have to be shipped, stocked, or refrigerated. You do not have to learn how enzymes interact, there is no competition, and GDI will not cause cancer. The simplicity of GDI is it’s greatest asset. There is a financial plague in this world, and Global Domains International is the cure. All you have to do is get started, then share it with others, and watch your dreams come true. Their dreams will also come true. It’s a wonderful feeling.

If you have been on the internet for any length of time looking at business options you will eventually come across someone promoting GDI to you. So this article is to answer some of the basic questions about GDI. Is this Business opportunity a scam? Do they have a product or service that is worthwhile? What is the potential of this opportunity? I will seek to answer these questions as objectively as possible.

Scam!?

If you have come to this article you are probably already considering whether GDI is a serious business opportunity or a scam! To determine if GDI is a scam the first question one must ask is are they marketing a worthwhile product or service or are they just another MLM or pyramid designed to take your money without giving you anything other than promises of great rewards and riches? The answer yes they have a genuine product/ service. In this case web hosting.

The Service Outlined

They provide a web hosting service. It is true you can get free website hosting on the net, in fact this very article is an example of a free web host and you can get good results from them, but there are a number of things you sacrifice.

Firstly if you are using a free web host provider there is always some form of cost, normally they require you to carry free ads on your site. (web1000 is an exception but you can’t even put banners on it and its editor is painful to use).

While having ads on your website at first this may not seem to be a problem, consider this, if you want this site to be your main business portal and hub, you may end up advertising your biggest competitor, not a smart move. You don’t have ownership of your site. You may own the intellectual material but if the free web hoster changes their rules, goes out of business or just updates the way their system works there is not a thing you can do about it. Even with blogger you have to share your AdSense revenue with them 50-50. That’s why I recommend if you are serious about having an online business your main site be one that you own and that means paying for it. Also after I lost 48 blogs overnight because blogger felt they didn’t all fit with their terms of service you learn – you get what you pay for.

In the case of GDI this means $10 a month. That’s US Dollars, so if you are in Australia like me, thats not so good, if you operate in Euro’s or pounds, that’s great for you. For that you get a web site, 10 pages (plus a feedback and guest page 12 total), 10 e-mail addresses and a domain name, its also includes a domain/site builder, domain and e-mail forwarding, use your own web builder, parking service. However each page can have a huge amount of data. The 10 e-mail address means if you have 10 different businesses, affiliates programs or whatever you can devote an individual e-mail to each one and can with the forward even arrange to have them forwarded to a single box.

The other great advantage is the ability to choose a domain name. Most of the good .com names are long since gone. Further in the case of many of the other endings like .au, .us, .uk, etc many companies exist solely in buying up the best domain names to make a killing selling them to someone else at highly inflated prices. GDI with the .ws avoids this pitfall by ensuring the domain name is not sold as a separate entity, but only with the web hosting service. This stops domain name hording in its tracks. .ws is still new and now is the time to get the domain name you want. No additional $20 yearly fee for just the domain name registration.

The Business Opportunity

The fact is not everyone out there needs a web host. Let’s examine why one has a website. Normally one either has a website for one of two reasons – BUSINESS or PERSONAL.

In the case of personal websites many people want their own personal e-mail addresses and have a website for a number of reasons, stay in touch with family with an open letter, express their beliefs or opinions on a world stage, to satisfied their own ego and sense of importance, create photo albums, join a community, etc. Some people will pay the $10 a month to have a website. As time progresses I think this will increase as more and more people become web aware and want to have their own address/ place on the web. With the highly transitive nature of the human population with greater movement than ever before in the history of the world one of the best ways people will be able to stay in contact with friends will be via the net. Consider how many people from school do you know twenty years later. Have you moved city, state, country, if you have you probably have lost contact with them. If you wanted to track them down how would you? I know I would do it via the web. This will be increasingly easy as people have personal web pages.

In the case of a website for Businesses most companies have a website for further advertising their company, some do have direct sales as well over the net, and some are nothing but internet based businesses, e.g. Ebay. In the case of a website for a business, I would think that what GDI offers is not big enough to meet their needs. Save for a landing page, redirect page or just the Domain name, GDI is aimed at the small internet business user. Thats not necessarily a bad thing but it is fact that has a bearing on the business opportunity. If GDI wants to grow further they will need to look at offering reasonable upgrade packages for the bigger players.

In the case of a small first time business wanting their own website with six pages GDI is not a bad option as it also gives them a source of secondary income.

It has the potential to be a good source of income as each person you bring in gets you $1 a month. Not a huge amount really, you would need 10 people just to pay for you hosting fee, but the winner here its that you get a $1 for each person they introduce down to five levels, the power to leverage the work of those below you is what appeals here. That can result in some good returns. You won’t become a millionaire over night, but you can have a great income stream.

You might be thinking, I’m too late and missed the GDI wave. No I don’t think so, not at this time this article is written. GDI members now are in the tens of thousands, not until its reaches 100′s of millions will the wave subside. I don’t think new customers will ever complete dry up either, because each year more and more tech savvy students finish school, and they brought up to believe they each need their own modern gadgets, including mobile phones, e-mailing, and even their own personal website. For kids who are spending $50 plus a month on mobile phones alone, $10 a month for their own website is nothing. I’m waiting for the day you no longer send in a resume into a prospective employer but just give them your web address and they can look up your life themselves. Thus I think the potential of GDI is long term, yes after the initial wave there will be an eventual slowing – there is no such thing as an infinite possibility – there are 6 Billion people on the planet, once the majority of them is a customer you have reach the finite limit. Any company unless they have plans to further develop a service or introduce new products knows a market does reach a saturation point where growth slows. Not so good for an MLM company as their customers are also their business partners. Any MLM that wants to succeed must either sell a product the needs replacement over time – i.e. tupperware (where did I leave that lid, oh well time to another party and order another), or offer new services or products to the same downlines.

There are numerous ways to advertise GDI online. I myself am no great salesman. I hate cold calling, I hate door knocking, I hate feeling like I am invading someone personal space or coming across as pushy. That’s why I love internet advertising. The buyer is in total control, no pushy salesman, don’t like the sales pitch go to another site. There are several program set up to advertise GDI for you, programs like turbo GDI and Hits2U, both are cost effective.

In summary, if you need a web host, GDI is a option, particularly in relation to Domain names, if you don’t need a web host and don’t know someone else who does then its probably not for you.

This article is the property of Alastair HARRIS and his immediate family. It may be freely republished over the internet but must include original links.
Alastair HARRIS is the main promoter the getfinancialfreedom4u family of websites, blogs and projects (visit http://getfinancialfreedom4u.ws) specializing in online business opportunities and education, income being generated by affiliate marketing, Google, GDI, eBay, and more. Alastair is rated as an expert author on numerous article directories and is very open to assisting others on the internet

Article Source: http://EzineArticles.com/?expert=Alastair_Harris

Article Source: http://EzineArticles.com/247151

History And Getting Involved With GDI – Global Domains International Review

Article Source: http://EzineArticles.com/5435157

You have been on the internet for some time now and came across this Network Marketing Company Global Domains International. Therefore, this article is about a Global Domains International review to see if it is a legit business opportunity or just one of those scams on the internet. You want to carefully do your due diligence if you can really make money in GDI.

What is Global Domains International (GDI). This is a company in their organization that is selling domain names, specifically dot WS domains nationwide, and GDI has established as a legit internet business in the past 10 years.

GDI is founded by the President, Alan Ezeir and CEO Michael Reed. Global Domains International got started as a company in 1999. It is a company that they provide domain names, web hosting, personal emails and websites. GDI was ranked as the 37th fastest growing company according to the USA by Inc. Magazines. Several of GDI’s clients like UPS, Yahoo, BMW, Ebay, Dell,etc. just to name a few. There are over 180 countries that are using the dot WS domain that is part of the Global Domain International community today.

The most popular domain that GDI established is to use dot WS, because a lot of well known businesses use dot com that are already been registered or taken. They can use dot WS as an alternative to grow their business on the internet during this decade of the digital age as we know it today. This is the reason why the founders decided to create another domain with Global Domains International. The growth of the company is a lot greater and expanding globally as we speak. It is frustrating to find the perfect name, coming from their experience that established dot com names can be resold at a high valued price.

Therefore, GDI is offering dot WS domains at an affordable price, not only in the United States but globally as well. Nevertheless, you definitely need to checkout Global Domains International review yourself if you’re in the home-based business industry. Nevertheless, if you’re interested in the GLD business opportunity and know people that have an interest in purchasing a domain for their business.

All you have to do get people to sign up with GDI. Therefore, you paid $1 for every member whom you sponsor into your downline. Therefore, you can receive weekly bonuses if you refer at least 5, 10, 15 recruits or team members into GDI. The typical bonuses you can receive are usually $100, $200, $300 subsequently. It isn’t a bad start to gain profit to get your Global Domains International off the ground. Nevertheless, you can potentially earn more income down the road as long you stick around long enough with GDI.

Are you going to prosper with GDI Company after reading this Global Domains International review? It all depends on you and willing to put in the work and hours if you want to be one of the top 3% in Network Marketing. You need to be serious and motivated to take your multi-level marketing business to the next level.

Nevertheless, you need to learn these skills that your GDI upline isn’t telling you. It doesn’t matter if it is the best opportunity out there in MLM, it is a MUST to learn these secrets that I will reveal to you if you ever want to explode your Global Domain International business and get more sponsors into your team if you really want to make a profit in this industry. I hope this Global Domains International review is very helpful in making your decision if are considering being a marketer with GDI.

Danny Yoon is a Author and Internet Marketing Expert that has been involved in the Network Marketing industry since 2007. He helps struggling entrepreneurs prosper with their own efforts with his simple online marketing strategies without pitching or promoting his primary business opportunity.

Learn more secrets for FREE and learn more about Global Domains International Review TODAY! It is a MUST if you want to be in the top 3% of Network Marketers to prosper in MLM and having your prospects chasing or calling you about your Global Domains International business opportunity!

Article Source: http://EzineArticles.com/?expert=Danny_Yoon

Article Source: http://EzineArticles.com/5435157

Get Started With A Discounted HostGator Account

Article Source: http://EzineArticles.com/5453802

As a reseller, it is in your best interest to find the best possible web host in the market. They should be able to provide you with all the benefits and advantages that you would need to make your business flourish. If you make a wrong decision and get stuck with an unreliable provider, your business will be badly affected and you will lose a lot of money in the process.

A good provider should be able to give you a great deal on the disk space and the bandwidth for your domains. This should also mean that you should have near-perfect uptime rates. They should also be able to provide you with a great monthly rate that you could easily afford – and most of all, they should give you peace of mind.

All these can be achieved through one of the most powerful web hosts in the virtual community – HostGator. This web hosting provider offers their services to global clientele. This means that wherever you may be around the globe, you can be able to obtain their services. One of the best benefits that you will gain from this provider is the fact that they will not force you in to a particular bundle or plan. It will be up to you to decide on which one would best fit your needs. If you are not quite certain about which one would best suit you, you can consult their support staff to help you make a smart decision.

The bandwidth and the disk space are specifically allocated for every plan or bundle. They provide countless domains, sub domains, email accounts and other applications. The servers are monitored 24 hours a day to ensure that you will have smooth flowing operations. You can get great value and advantages with their guarantee of providing you with 99.9% up time at all times. Should you have any concerns, you can be assured that it will be handled with efficiency and provide you feedback in the soonest possible time.

If you are wondering about the rates and would want to have savings – especially if you would want to try it out before you commit long term, you can get a discounted HostGator account. You can find coupon codes that will provide you with great discounts for your initial charges. As you proceed with your order, you will be required to complete the application forms provided in their website. This means that you would need to provide all the pertinent information required to process your order. You will come to a page that will prompt you to enter the coupon code. Before you confirm your order, you will be taken to a preview or summary page where you will see the discounts applied to your account. As this is likely going to make you happy, you will get more confidence and peace of mind in knowing that you can get your money back for up to 45 days from initial service – should you have any reason for wanting to cancel your account.

Are you looking for more information regarding discounted HostGator account? Visit http://www.discount-hosting-company.com/ today!

Article Source: http://EzineArticles.com/?expert=Lindsey_Jenkins

Article Source: http://EzineArticles.com/5453802

Free GDI Downline Builder

admin — Wed, 01 Sep 2010 16:09:06 +0000

Hi my name is Benjamin King and I have been marketing GDI with a free GDI Downline Builder, actually it is a marketing system called The Bear Marketing System . What the Bear Marketing System does is bring together several different Affiliate Programs and allows you to promote all of them with the same link. By doing this you are able to achieve signups not only in Global Domains but also in all of the other affiliate programs and only as if you were promoting the one program.

The Bear Marketing System helps you market GDI (Global Domains International), PeopleString, Aweber and VIP Forums.

It works because it is FREE and allows people to easily provide something of value to their members. People don’t always want to sign up to GDI when you promote it on its own but as soon as you show them a marketing system like this one where they can use their GDI website to promote several affiliate programs all at the same time then they suddenly become a whole lot more interested.

You can sign up for your Free Bear Marketing System here.

Global Domains – How to Make Money Online with the best program

admin — Sat, 21 Aug 2010 04:00:39 +0000

WATCH THE VIRAL PDF GENERATOR VIDEO ON HOW IT WORKS RIGHT HERE

WANT FREE PLUGINS, THEMES, SEO TECHNIQUES AND STRATEGIES FOR YOUR WORDPRESS BLOGS? CLICK HERE

Learn How To Make Money Online With the best program and get acces to the biggest online gallery … of products

Money Online| Bux.to How to Make Money Online With MySpace [RS] FASTEST MONEY MAKER reviews tips tutorial tricks Profit Site Make Money Complete Money Making Site Setup FREE! How to Make Money With Google AdSense Wow make money online easy $6000 per Week How To Make Make Money Online! Follow me and learn How To Make Money Online With YouTube Make Money Online Make Fast Sales With Ebay “Make Money Online with Online MLM Free Skype Traffic $1 Martix Earn $1000′S PROVEN!! My Search Funds Make Money Make money, Get Paid to Search!! free money, pay to click, pay to read, pay to survey Make Money With Every Google Search MAKE MONEY
Get your free internet business strategies and internet marketing tips to get your profits soaring. Internet Marketing, Search Engine Marketing, tricks full part time by Internet marketing, buy sell search engine marketing and online marketing web site offering businesses the opportunity to enhance their online presence through media Internet Marketing & Online Marketing Internet Marketing by Online Marketing to get more website visitors and leads in search engines (SEO), blogs, social media. Google AdSense – Making Money With AdSense Is making money with Google Online Millionaire Marketing Secrets! Now, before I reveal how you can grab your personal copy of this amazing, earn using what these experts reveal(Youtube Video) internet myspace google adsense making make money online cash online business youtube video opportunity expert reveal how-to-make-money-online internet myspace adsense making make money cash online business youtube video work from opportunity myspace google facebook home better than Adsense Forex Web 2.0 Abunza EZ20 Cash Gifting Clickbank when what now soon fast easy quick cash six figure mlm the best way to make money online. Make Money Online, GDI Review, Best Online Jobs, Best Affiliate Programs, Make Money Online Marketing arrow How to Make Money. Adsense is a Google How to Make Money Using Google’s AdSense and AdWords One of the latest online money making strategies is to use Google’s AdSense and or to use Google’s AdWord programs. Each of these programs has the potential How To Make Money Online Quick With Google Adsense Many people think its hard to make but people are making money 1000 Real Millionaires Reveal Their

Category:
Howto & Style

Tags:
LearnHowToMakeMoneyOnlineWithGDImoneyblogsblogadvertisinglinkspaidmakingadvertiseearnmonetizemarketinginternetbestwebrssbloggingwhatishowtodofreesitescashsearchdesignbusinessfinancialsales39fortune

Best Affiliate Program to Make Money Online in 2010 with GDI

admin — Mon, 19 Jul 2010 07:57:15 +0000

Global Domains would have to be one of the easiest ways to make money online right now and just by looking at the GDI leaderboards below you can see just how much these affiliate / internet marketers are able to make. What I want to show you though is how to market gdi using a Free Marketing System.

Now you may or may not have heard of the Bear Marketing System but basically it is a marketing system that brings together more affiliate programs than just GDI. A few of the other affiliate programs it shows you how to use is :

Of course Global Domains International is included in this list.
Global NPN
PeopleString
The VIP Forum

What the Bear Marketing System does is bring together not only income earning streams from GDI but also from those companies to give you the potential of $300 per signup!!!

Join Now for your free marketing system

The Global Domains Leaderboards show you just a fraction of the earning potential available with this company. They also pay you residual income each and every month. Have a look at this video to see Proof of earnings with GDI straight to Paypal

Weekly Potential Leaderboard
Covers New Signups for the Week of 07/12/2010 – 07/18/2010

Amount New Signups Affiliate Name City State Country
$800 40 Paul Cherry Sebastian FL US
$500 29 Tissa Godavitarne Herndon VA US
$500 28 Tim Sebert Waxhaw NC US
$500 27 Ash Mufareh Corp Cupertino CA US
$400 22 Wilmer Brice�o Quispe Villa El Salvador Lima PE
$300 17 GDI Website Leaders Penfield NY US
$300 16 Virasak Aromsuk Bangplee SAMUTPRAKARN TH
$300 15 Randy Beck Sioux Falls SD US
$300 15 Pittaya Kinsungnoen Sungnoen NAKHON RATCHASIMA TH
$200 14 Amirul Ashraf Mhd Yusof Padang Serai KEDAH MY
$200 13 Estopheles Gray Los Angeles CA US
$200 13 Keith Kearney Poughkeepsie NY US
$200 12 Maria Isabel Arellano Loza San Nicolas de los Garza NL MX
$200 11 Adul Papho Paputtabat SARABURI TH
$200 11 In Demand Inc. Port Saint Lucie FL US
$200 11 Robert Edwards Staunton VA US
$200 10 William Jackson Vancouver BC CA
$200 10 winai Jantarik Thaimeang PHANGNGA TH
$100 9 Bear Marketing Taylor MI US
$100 9 Octa Rendra Bekasi West Java ID
$100 9 Jose Canto Puebla PUEBLA MX
$100 8 Stone Evans Dallas TX US
$100 8 Mathieu Bisson Leduc AB CA
$100 8 Travis Alexander Los Angeles CA US
$100 8 Kim’s Internet Enterprises, LLC Westminster CO US
$100 8 Rungrote Pengartis Ayutthaya AYUTTHAYA TH
$100 8 Valentina Fraser Vancouver WA US
$100 8 Tanakit Kongboonvijit Nakhonpathom NP TH
$100 7 Orlando Zambito Sora FR IT
$100 7 Kittipong Yenbankuan Bangkok TH
$100 7 Jeremy Henderson Rockwall TX US
$100 7 Lelio Farias Vila Velha ES BR
$100 6 Abdullah Yasin Amman JU JO
$100 6 Iwan Chandra Medan Sumut ID
$100 6 Gary Pasek Hales Corners WI US
$100 6 M Sahir Bangalore KA IN
$100 6 Steve Little Denver CO US
$100 5 Trevor Hovick Edmeston NY US
$100 5 Dentor Dapon Stockton CA US
$100 5 John Garvin Brooklyn NY US
$100 5 Henry Smith London ENGLAND GB
$100 5 Joe Reinbold Morganville NJ US
$100 5 Adnan Sut Wien Austria AT
$100 5 Kyle Kim Elizabeth NJ US
$100 5 Laurence Doyle Saint Charles MO US
$100 5 Leo Rodgers Nassau Bahamas BS
$100 5 Mhd Yusof Abd Ghoni Padang Serai KEDAH MY
$100 5 Miguel Torres San jose de las matas SANTIAGO DO
$100 5 Natthaphong Sirisrimangkorn Thunyaburi PRATUMTHANI TH
$100 5 Wiwat Marakrong Muang Distric UBON RATCHATANI TH
$100 5 Steven De Gracia Sunnvale CA US
$100 5 Eduardo Fernando Benito Hernandez Bogota Cundinamarca CO

How to Succeed with GDI and get Free Signups

admin — Sun, 18 Jul 2010 08:00:53 +0000

If you are looking to succeed and get a ton of signups with GDI but don’t have a lot of Internet Marketing experience then it can still work for you.

In fact when I first joined GDI I had absolutely no knowledge of Internet Marketing and joined through a FREE Marketing System called the Spiderweb Marketing System.

There is a lot of money to be made online as an affiliate and GDI (Global Domains International) is no different. I like the idea of earning residual income month after month for the same people being in my team which is why I first chose GDI as my online home business.

Brian Bear who is one of the top leaders in GDI has come up with a brand new marketing system called the “Bear Marketing System” and what it actually does is promotes several affiliate programs for you all at the one time without you ever having to give out several different links

Think of companies such as Global Domains and PeopleString. You can make up to $300 per referral using the Bear Marketing System and best of all the marketing system is completely 100% free to join.

I have been with Global Domains for nearly 2 years now and I am making money online with them. You can be paid via check or Paypal. I find Paypal is the easier payment method and it is instant.

If you are serious about making money online then I suggest you check out my guide on Making Money with GDI.Click here for free information on joining GDI (Global Domains International)

WANT TO SIGN UP WITH GDI TODAY? WATCH THIS VIDEO FOR PROOF OF EARNINGS THROUGH PAYPAL

If you are already a GDI member make sure you get into the FREE Bear Marketing System, you have nothing to lose it is 100% FREE and it gives you the power to make money outside of GDI on 7 different income streams.

Top Ways to Make Money Online in 2010

The Success Principle

Money Siphon System V2

Nasty Dirty Money

The Affiliate Code

Copy Paste Systems

Hubpages Affiliate Blueprint

Express Paid Surveys

GDI – How To Make Free Money Online For Paypal For Free 2010

admin — Thu, 15 Jul 2010 04:49:36 +0000

http://globaldomainsinternationalwebs… How To Make Free Money Online For Paypal For Free 2010

how to make money online for paypal
how to make free money for paypal

“MAKE MONEY ONLINE” YouTube Best Way to “Make Money Online” Earn $500 Daily “MAKE MONEY ONLINE” Here’s a new way to “make money online”

New Ways to “Make Money Online” « With so many ways to earn online old and new it is getting more and more difficult “MAKE MONEY ONLINE” Here is a free download on 51 ways to make more money online. “MAKE MONEY ONLINE” YouTube Best Way to “Make Money Online” Earn $500 Daily “MAKE MONEY ONLINE” Here’s a new way to “make money online” and for many people to “MAKE MONEY ONLINE” “Earn Money Online” for Free “How to Make Money Online” MAKE MONEY ONLINE. Are you looking for new ways to drive more Internet user traffic to your website or blog without “MAKE MONEY ONLINE” Online Jobs | “Work From Home” | Free Registration | Data Entry Jobs “MAKE MONEY ONLINE” Make money and win cash. This database of paying surveys is FREE. “MAKE MONEY ONLINE Google Adsense – Easiest and Fastest Way to Earn Money Online (Available Worldwide) MAKE MONEY ONLINE FREE MONEY TEAM – Make Money Online for Free and Earn Free Cash! If you have been looking for a smart and quick way to earn FREE daily MAKE MONEY ONLINE. I Want To Earn Money the Smart Way and Explode My FREE Income Online Quickly! MAKE MONEY ONLINE Your Daily Payday!* There is NO EASIER WAY to make money online than with our Automatic Profits MAKE MONEY ONLINE Cash Generating Websites That Earn You 100%MAKE MONEY ONLINE New Software, Products MAKE MONEY ONLINE Earn Free Linden Dollars and Make Money Online through Second Life “MAKE MONEY ONLINE” Where to earn those free linden funny dollars, make money in Second Life and find MAKE MONEY ONLINE or site which will provide ways for you to e Earn Money Online – Ways To Make Easy Money Online! – Video Here’s a NEW way of HOW TO EARN MONEY ONLINE, while using your PC or Computer. MAKE MONEY ONLINE FREE Method To MAKE MONEY ONLINE Earn Make Money Online 7 Ways to Make Money Online Without Involving Internet Marketing MAKE MONEY ONLINE allow publishers to display cost-per-action (CPA) Google ads and earn commission when a MAKE MONEY ONLINE Make Money Online With Top Free Sites. Earn Money With Free Online MAKE MONEY ONLINE Make Money Online – Get paid with free get paid to write, get paid to read and MAKE MONEY ONLINE You will be able to view your earnings on a daily basis when you sign up

if you want to make money online,i found this site last week How to Make Money Online How to Make Money Online Easy $7000 Work from Home FREE How I Make Money Online How To Make Money With No Money Make Money Online FREE – EASY WAY $12,000 REAL Money Online How to Set Up Google Adwords & start “MAKING MONEY ONLINE” ! how to make money online best work from home job fastest easiest youtube myspace facebook jobs internet ways where reviews tips tutorial new How to Make Money Online With MySpace Start “MAKING MONEY ONLINE” with Google PPC Adwords Today! How To Make Money Using Ebay – Make Fast Sales With Ebay HOW TO MAKE MONEY ONLINE 100% FREE Technique Earn $500 Daily Make Money Online Now Free Sign Up No Risk Make Money Online” with Items Work at home make money online FREE Marketing System Brian Bear
Make Money Fast: Tips on tutorials Cash in the Next Few Days Make Money Online Fast easy FREE to “do stuff” or “sell stuff” in order to earn money. Make Money Online Fast easy FREE how to make money online. how to make easy money fast. latest blog posts. coupons for your budget Make Money Online Fast easy FREE FREE Quick and Easy Money Makers Earn $500 + FREE Make Money Online eBooks. Tips Make Money Online Fast easy FREE online | How to make money on the Internet on Make $35 fast: Make Money Online Fast easy FREE How to make money online with Pets on Tuesdays | Make money online Make Money Online Fast easy FREE Earn $25 + download 25 FREE Make Money Online eBooks. Tips
How To Make Money Online Easy And FREE [PROOF] LOOK HERE With Youtube myspace
How to Make Money Online Fast [BEST Online Job] Easy Brian Bear brian+bear bearteam marketing

How to Make Money Online How to Make Money Online How to Make Money Online How to Make Money Online How to Make Money Online

Category:
Howto & Style

Tags:
HowToMakeFreeMoneyOnlineForPaypal2010GetPROOF1000Makingbestworkfromhomejobfastesteasiestfasteasysimplemaking money online

How to Make Money Online with PeopleString, GDI, Infinity Downline as an Affiliate

admin — Wed, 14 Jul 2010 04:34:51 +0000

Also check out my guide to Making Money with Tradebit and Hubpages

views 0
views
JobsFromHomeOz | July 13, 2010

http://www.makemoneyonlinef…

If you want to know how you can make money onli…
JobsFromHomeOz | July 13, 2010

http://www.makemoneyonlinefreeinfo.com

If you want to know how you can make money online with affiliate programs such as PeopleString, GDI and Infinity Downline then the Bear Marketing System is definately the system for you. My name is Benjamin King and I am a 27 year old Internet Marketer from Ryde, Sydney, Australia.

I have been an Internet Marketer for 2 years now and have worked with many affiliate programs such as Clickbank, Commission Junction, Adsense. The key to being succesful with any affiliate programs is having good quality landing pages as well as high quality targeted traffic.

I have chosen to market my programs with video marketing as well as social media websites such as Hubpages, Twitter and Facebook. There are thousands of websites out there that you can successfully use to market your affiliate program but what if you could have one marketing system to bring them altogether. This way you only need to share the one link and you have the ability to market across several affiliate programs with the click of a button.

The marketing system is known as the (BMS) Bear Marketing System and was designed by Brian Bear who was and still is a top affiliate of GDI (Global Domains International) and The Spiderweb Marketing System. You have the ability to market affiliate programs such as People String and the Infinity Downline system. Best of all you can choose what you want to sign up for and market. If you choose not to go with the Infinity Downline Affiliate Program for instance you can simply leave it out and go on to the next step.

I like to market with social media such as Hubpages and Twitter because of the interaction with your customers but you can use other methods if you want, although when you join with me I will give you access to my marketing traffic strategy for getting visitors to Hubpages. It comes in a PDF Ebook and is your Blueprint to success if you want it.

Visit http://www.makemoneyonlinefreeinfo.com for more information.

Thanks
Benjamin King your GDI sponsor

Category:
Howto & Style

Tags:
MakeMoneyOnlineGDIPeopleStringAffiliateInfinityDownlineHubpagesKittipongBrianBear

Also check out my guide to Making Money with Tradebit and Hubpages

Best Way to Earn Money Online 2010 for Canada, Australia, Thailand Worldwide

admin — Tue, 22 Jun 2010 14:41:58 +0000

I MADE OVER $1,000 LAST MONTH WITH EZINEARTICLES – SEE THE STEPS I TOOK TO MAKE IT HAPPEN – CLICK HERE – FREE INFO

NEVER NEED THE SEARCH ENGINES FOR YOUR TRAFFIC AGAIN!!!

1,093,333 Visits without a Search Engine – Click here

With lots of new Internet Marketing / Home Businesses showing up online each and every day it can be a very hard task trying to find the ones that are suitable for you and will actually make you money online. More times than not people give up before they find something suitable online for one reason or another. I am going to show you an Internet Business that will never be a saturated market and will continue to show growth on your downline and income.

I am going to show you proof that this system works through a video, logging into accounts through GDI and Paypal. Also be sure to look at the Leaderboards at the bottom of this page to see the sort of earnings members are making each and every week using this very simple business.

Whether you are from Canada, Australia, Thailand or pretty much anywhere else in the world for that matter you can highly benefit from this business. The business I am talking about is GDI ( Global Domains International ). Watch the video below.

If you look you will see a lot of big Internet names such as Ewen Chia Ti Wah, and Stone Evans, all of these people use Global Domains and some of them have their own systems in place to get signups such as Plug – In Profits, ACME People Search, Spiderweb Marketing System etc. I am going to show you a way that you can make money with Global Domains using Youtube, Article Marketing, Facebook, Myspace, Twitter and other social networking and media websites. This is an “Network Affiliate Program” with a difference and that is that you will never have to hassle your family or friends to get signups within GDI. Sure if you want to send them an invite to join Global Domains then that is fine too but we show you how to get leads and signups from people you never even know and our well put together marketing system brings the leads in and takes care of the rest.

Being able to Make Money Online has gotten a whole lot easier over the last couple of years thanks to the advancements of the Internet that we are constantly given. Affiliate Marketing is a free and quite an easy way to make money online. I have been over the last 2 years, involved in several Affiliate Marketing ventures with Global Domains International (GDI) as well as Clickbank and Marketing through EzineArticles and Hubpages.

I went from earning around $35,000 per year to $75,000 in my first year of Internet Marketing and am on track to earn around $140,000 for this financial year (my 2nd year in Affiliate / Internet Marketing thanks to some very good opportunities that have come along over the last few months.

Global Domains International (GDI) is a web hosting / domain company with a difference. They not only offer you the chance to own your own website with hosting included for just $10 per month but they also offer you a unique business opportunity within GDI. This opportunity allows you to refer new members into GDI for their chance to own their own website with hosting and GDI pays you for referring them in. I also have a Free Report for GDI members showing you ways I have made money using GDI. You can download that FREE REPORT by clicking the Download Now button below.

Download Now!!!

So how can Global Domains International (GDI) afford to pay you?

GDI can afford to pay you a residual income on every one you refer for LIFE because they have factored this into the cost they charge monthly for members to be part of this company. That $10 you pay every month allows them to pay the people that referred you to GDI and the people that referred them and so on, 5 levels deep!! This means that if you refer 5 people and those 5 people refer 5 people and so on 5 levels deep then you have the potential to earn a monthly residual income of $3,900 each and every month for the rest of your life. Not only do they pay you on this level but if you are a GDI Premium Member you can get paid weekly bonuses on top of this, for each 5 members you signup within a 7 day period starting on Monday morning and ending Sunday night you will be paid $100. If you refer 50 members for the week you will be paid a $1,000 bonus.

more »
HubPages

Now I know you are thinking that this offer sounds too good to be true and that is why I have included video footage showing Brian Bear logging into his GDI and Paypal accounts as proof that this system works and works very well. When you join with me you also get support from Brian Bear through his training centre as well as support through myself with the ways that I have been marketing GDI. I have learnt a lot about marketing with affiliate programs and I will also teach you additional ways to make money online besides GDI as a bonus just for signing up with me. It is that easy and all you will pay is $10 a month. On top of all that you also get a FREE 7 day trial to see if GDI is for you. If you don’t like the program then you can quit in those 7 days and you wont be charged a penny.

Watch this GDI Video by Brian Bear below for proof of payment!

Making Money with Hubpages and Clickbank and GDI

Hubpages is an excellent way to make money with your Affiliate Programs. A lot of people think of Hubpages as an alternative to blogging and most people think that you can only make money with Hubpages through Google Adsense. While Adsense is another way you can make money with Hubpages you can also make a whole lot more money by marketing products through Clickbank and also promoting GDI. I have signed up many members through the use of Hubpages over the last couple of years and think that this is one of the best methods on the Internet. Visit Earning with Hubpages for more information.

Harvey Segal Ultimate Supertip Ebook – Clickbank Internet Marketer

I have also been marketing Harvey Segals Ultimate Supertip Ebook with a great deal of success. The book involves downloading it completely FREE right here. Click here to Download a COPY of the Ultimate Supertip right now!! You then use Internet Marketing to give this book away and make money straight to your Paypal account even though you are giving the book away free. Sounds crazy doesn’t it!! It works though, trust me and I have the proof for you right here. Visit Proof of Payment with Paypal for more information.

I have also included this weeks GDI Leaderboards for you to view the GDI members who received a bonus weekly commission on top of their monthly residual income for LIFE!

Weekly Leaderboard for this week with Global Domains International (GDI)

Weekly Potential Leaderboard
Covers New Signups for the Week of 06/14/2010 – 06/20/2010

Amount New Signups Affiliate Name City State Country
$600 30 Tanakit Kongboonvijit Nakhonpathom NP TH
$500 28 Tissa Godavitarne Herndon VA US
$400 22 Tim Sebert Waxhaw NC US
$400 21 Sergio Arturo Bravo Zarate San Nicolas de Los Garza NL MX
$400 20 GDI Website Leaders Penfield NY US
$300 18 Virasak Aromsuk Bangplee SAMUTPRAKARN TH
$300 18 Nicholas Gregory Staunton VA US
$300 17 Natthaphong Sirisrimangkorn Thunyaburi PRATUMTHANI TH
$300 16 Pittaya Kinsungnoen Sungnoen NAKHON RATCHASIMA TH
$200 13 Valentina Fraser Vancouver WA US
$200 12 Stan Tomaszewski Lewiston NY US
$200 11 Bear Marketing Taylor MI US
$200 10 Randy Beck Sioux Falls SD US
$200 10 Supawadee Tarunanon Bongbon BANGKOK TH
$200 10 David Pastrana Lima LIMA PE
$100 9 William Jackson Vancouver BC CA
$100 9 Wiwat Marakrong Muang Distric UBON RATCHATANI TH
$100 8 Stone Evans Dallas TX US
$100 8 Kyle Kim Elizabeth NJ US
$100 8 Joey Lyell Sharon TN US
$100 8 Ekkachai Taimuang Muang PHUKET TH
$100 8 Iwan Chandra Medan Sumut ID
$100 7 Rungrote Pengartis Ayutthaya AYUTTHAYA TH
$100 7 Ewen Chia Ti Wah Singapore SINGAPORE SG
$100 7 Adnan Sut Wien Austria AT
$100 7 Paul Cherry Sebastian FL US
$100 7 In Demand Inc. Port Saint Lucie FL US
$100 7 Travis Alexander Los Angeles CA US
$100 6 Kevin Hass Wylie TX US
$100 6 Octa Rendra Bekasi West Java ID
$100 6 Nor Asiah Karib Petaling Jaya SELANGOR MY
$100 6 Kittipong Yenbankuan Bangkok TH
$100 6 T J Rohleder Hillsboro KS US
$100 6 Robert Edwards Staunton VA US
$100 5 Rina Baxter Hoffman Estates IL US
$100 5 Scott Cheatham Milwaukee WI US
$100 5 Shawnta Clark Sanford FL US
$100 5 Sean Sears Fort Myers FL US
$100 5 Ernesto Mabaso Cebu City CEBU PH
$100 5 Pedro Familia Santiago SANTIAGO DO
$100 5 Nestor Guerrero Miraflores LIMA PE
$100 5 Mathieu Bisson Leduc AB CA
$100 5 Mike Fatoullah Great Neck NY US
$100 5 Jaruwan Kanthain Sankamphaeng CHIANGMAI TH
$100 5 Everald Flowers Miami FL US
$100 5 Damon Arnold Kansas City MO US
$100 5 Ronnie Lewis Ocala FL US
$100 5 jahanzeb ailia london GB
$100 5 Kumar Abhijeet Suita OSAKA JP
$100 5 Adul Papho Paputtabat SARABURI TH

Weekly Potential Leaderboard
Covers New Signups for the Week of 05/31/2010 – 06/06/2010

Amount New Signups Affiliate Name City State Country
$1100 58 Tissa Godavitarne Herndon VA US
$600 31 Paul Cherry Sebastian FL US
$500 28 Tim Sebert Waxhaw NC US
$400 20 Pittaya Kinsungnoen Sungnoen NAKHON RATCHASIMA TH
$300 18 Rungrote Pengartis Ayutthaya AYUTTHAYA TH
$300 18 Natthaphong Sirisrimangkorn Thunyaburi PRATUMTHANI TH
$300 15 William Carroll Roswell GA US
$200 14 Virasak Aromsuk Bangplee SAMUTPRAKARN TH
$200 14 Kittipong Yenbankuan Bangkok TH
$200 13 Randy Beck Sioux Falls SD US
$200 13 Stan Tomaszewski Lewiston NY US
$200 13 Titipat Boonchum Kut-Chum Yosothon TH
$200 12 Bear Marketing Taylor MI US
$200 11 Sergio Arturo Bravo Zarate San Nicolas de Los Garza NL MX
$200 11 Nor Asiah Karib Petaling Jaya SELANGOR MY
$200 10 Stone Evans Dallas TX US
$100 9 Tanakit Kongboonvijit Nakhonpathom NP TH
$100 9 Mathieu Bisson Leduc AB CA
$100 9 Petar Novakovic Rijeka Croatia HR
$100 8 Ewen Chia Ti Wah Singapore SINGAPORE SG
$100 8 GDI Website Leaders Penfield NY US
$100 8 Joey Lyell Sharon TN US
$100 8 In Demand Inc. Port Saint Lucie FL US
$100 8 Valentina Fraser Vancouver WA US
$100 7 Izabela Kiljan Auckland AUCKLAND NZ
$100 7 Nicholas Gregory Staunton VA US
$100 7 T J Rohleder Hillsboro KS US
$100 7 William Jackson Vancouver BC CA
$100 7 Keith Kearney Poughkeepsie NY US
$100 6 Iwan Chandra Medan Sumut ID
$100 6 Chokchai Sirorattanakul Muang PATHUMTHANI TH
$100 6 Jorge Guerrero Panama PMA PA
$100 6 Danny Alex Lachos Perez Chiclayo – Jose Leonardo Ortiz PE
$100 6 Henry Smith London ENGLAND GB
$100 6 Vorayuth Sopananugul Samphan NAKHONPATHOM TH
$100 6 Adnan Sut Wien Austria AT
$100 6 Ken Rankin Fremont CA US
$100 6 Bupparit Loungprom samphan NAKHONPATHOM TH
$100 6 Pongsak Mormungkun vattana BANGKOK TH
$100 6 Wiwat Marakrong Muang Distric UBON RATCHATANI TH
$100 6 Kevin Hass Wylie TX US
$100 6 Travis Alexander Los Angeles CA US
$100 5 Cynthia Minnaar Pietermaritzburg KWAZULU NATAL ZA
$100 5 David Pastrana Lima LIMA PE
$100 5 Gabor Fenyes Szeged Csongrad HU
$100 5 Jikly Batista Union City NJ US
$100 5 Ana Lia Sepulveda Ramirez Cali VALLE DEL CAUCA CO
$100 5 Tim Nagle Colorado Springs CO US
$100 5 C.S Park Buchen GY KR
$100 5 Ernesto Mabaso Cebu City CEBU PH
$100 5 supawadee worrapimrut mung TH